PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G001600.1
Common NamePOPTR_0005s00340g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 442aa    MW: 49114.6 Da    PI: 7.4805
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G001600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+++++++G g+W+++++   + R++k+c++rw +yl
  Potri.005G001600.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKQADLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding44.43.9e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Potri.005G001600.1  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.868965IPR017930Myb domain
SuperFamilySSF466895.62E-2912108IPR009057Homeodomain-like
SMARTSM007172.3E-121363IPR001005SANT/Myb domain
PfamPF002493.6E-151461IPR001005SANT/Myb domain
CDDcd001674.63E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2565116IPR009057Homeodomain-like
SMARTSM007172.9E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129420.12666116IPR017930Myb domain
PfamPF002494.7E-1367110IPR001005SANT/Myb domain
CDDcd001676.14E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKQADLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLS EVENCKEKQQ PTADKSNEKV SNVSNELNLI EAATLQPPAI SSSSKINNSK  180
DRNSSSSNMT NTPPTKEFFL DRFGTSHESS PASCRPSDLM GYFPFQKLDY KPSIGLSMNP  240
NTTLCFNPNS SSEMISHEFN SCMTPPTILP SVSTSMFQTP IRVKPSVSLP SDHNPSVGSC  300
DVNGVQNWEA SSFSNNGSGS NGSSSSIELQ SNTNFYESSA FSWGLANCGK SGEESHLRSL  360
ENDTAEDIKW SEYLNTTFFL GSTIQNQTSQ HVYSEVKPET HFIAEGSSAS WIPNQHQQAS  420
QPADIYTKDL QRLAVAFGQS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017490.0JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382251.10.0myb family transcription factor family protein
TrEMBLB9N4050.0B9N405_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0005s00340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-130myb domain protein 61